<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patMAK 01_MAK719 France 2001 HIV1 CRF11_cpx Plasma None

Treatment History
Order Regimen Weeks
1 DDC+ AZT 35
2 DDI+ AZT 22
3 DDI 9
4 3TC 12
5 DDI+ D4T 4
6 DDI+ D4T+ 3TC 20
7 SQV+ RTV 47
8 SQV+ NFV 13
9 SQV 1
10 SQV+ AZT+ 3TC 31
11 SQV+ RTV+ AZT+ 3TC 90
12 LPV+ 3TC 17
13 NVP+ LPV+ 3TC 4

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V F53L L10V, I13V, K14R, G17E, K20I, E35D, M36I, R41K, H69K, T74A, L89M  
>01_MAK719| codons 1-99
PQITLWQRPVVTVRIGEQLIEALLDTGADDTVLEDINLPGKWKPKIIGGIGGLVKVRQYD
QILIEICGKKAIGAVLVGPTPVNVIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q G190A   V35T, T39N, E40D, V60I, K101Q, I135T, K173T, D177E, V179I, T200A, Q207K, D218E, V241G  
>01_MAK719| codons 1-244
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICNDMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEIII
YQYVDDLYVASDLEIGQHRAKIEELRKHLLRWGFTTPEQKHQKEPPFLWMGYELHPDKWT
GQPI

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004