<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patBRI 01_BRI705 France 2001 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 DDI 61
2 None 26
3 DDI 21
4 D4T+ 3TC 26
5 SQV+ D4T+ 3TC 82
6 NFV+ AZT+ 3TC 17
7 SQV+ RTV+ AZT+ 3TC 12
8 NVP+ AZT+ 3TC 1
9 AZT+ 3TC 7
10 NVP+ AZT+ 3TC 21
11 DDI+ AZT+ 3TC 34
12 LPV+ DDI+ D4T 8
13 LPV+ DDI+ D4T+ 3TC 27

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   G190A A98G E6D, K11T, V35I, T39R, K43E, E44D, S68G, V118I, K122E, D123S, K173T, Q174K, D177E, V179I, T200A, E203K, Q207D, L228H  
>01_BRI705| codons 1-242
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALIEICRELEEDGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIII
YQYVDDLYVASDLEIGQHRAKIKELRDHLWRWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L33F, F53L, T74P L10I, I13V, I15V, K20R, E35D, M36I, N37D, R41K, K55R, R57K, H69K, K70R, L89M  
>01_BRI705| codons 1-99
PQITLWQRPIVTVKVGGQLREALLDTGADDTVFEDIDLPGKWKPKMIGGIGGLVRVKQYD
QILIEICGKRAIGPVLVGPTPANIIGRNMLTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004