<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patBRI 00_BRI706 France 2000 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 DDI 61
2 None 26
3 DDI 21
4 D4T+ 3TC 26
5 SQV+ D4T+ 3TC 82
6 NFV+ AZT+ 3TC 17
7 SQV+ RTV+ AZT+ 3TC 12
8 NVP+ AZT+ 3TC 1
9 AZT+ 3TC 7
10 NVP+ AZT+ 3TC 21
11 DDI+ AZT+ 3TC 19

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   G190A A98G E6D, K20E, V35T, T39R, K43E, E44D, S68G, K122E, D123S, K173T, Q174K, D177E, V179I, T200A, Q207A, R211E, E224K, L228P  
>00_BRI706| codons 1-236
PISPIDTVPVKLKPGMDGPEVKQWPLTEEKIKALTEICRELEEDGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIII
YQYVDDLYVASDLEIGQHRAKIEELRAHLWEWGFYTPDKKHQKKPPFPWMGYELHP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, K20R, E35D, M36I, N37D, R41K, R57K, H69K, T74S, L89M Q7P
>00_BRI706| codons 1-99
PQITLWPRPLVTVKVGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGSVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004