<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patVERD 00_VERD709 France 2000 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 DDI 95
3 SQV+ DDI 34
4 IDV+ D4T+ 3TC 56
5 NFV+ D4T+ 3TC 12
6 D4T+ 3TC 117

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12K, I13V, K14R, K20I, E35D, M36I, R41K, H69K, V82I, L89M  
>00_VERD709| codons 1-99
PQITLWQRPLVKVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215Y K219Q     V35T, T39N, E40D, V60I, K122E, I135V, K173T, Q174R, D177E, I178L, T200A, I202V, Q207E, R211K  
>00_VERD709| codons 1-236
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICNDLEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTRNPELVI
YQYVDDLYVGSDLEIGQHRAKVEELREHLLKWGFYTPDQKHQKEPPFLWMGYELHP

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004