<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patRAU 02_RAU722 France 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 4
2 DDI+ AZT 78
3 AZT+ 3TC 56
4 NVP+ AZT+ 3TC 203

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   K103N, P236L A98G K43E, I135M, S162A, T200A  
>02_RAU722| codons 27-237
TEEKIKALVEICTELEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQD
FWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSMNNETPGIRYQY
NVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELR
QHLWRWGFYTPDKKHQKEPPFLWMGYELHLD

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005