<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patBOUI 01_BOUI703 France 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 78
2 AZT+ DDC 43
3 3TC+ AZT+ RTV 4
4 3TC+ AZT+ IDV 134
5 3TC+ AZT+ NFV 82
6 DDC+ EFV+ SQV 36

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D L10I, L63P, I64L, H69Q, T74S, V77I  
>01_BOUI703| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPLEICGQKAIGSVLIGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215Y K219Q K103N, Y181C K101N D123E, I142V, K166R, I178M, Q197L  
>01_BOUI703| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLNKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDMVI
CQYMDDLYVGSDLEIGLHRTKIEELRQHLLRWGFYTPDQKHQKEPPFLWMGYELHPDKWT
VQ

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005