<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patRAM 02_RAM705 France 2002 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT 47
2 Unknown 165
3 3TC+AZT 73
4 Unknown 92
5 3TC+D4T+RTV 40
6 3TC+D4T 6
7 3TC+D4T+IDV 49
8 3TC+D4T+IDV+RTV 7
9 3TC+D4T+RTV 24
10 EFV 25

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V   K103N, Y188L   V35T, E40D, K43R, V60I, A98S, K122E, D123S, I135T, E138A, S162A, K173T, Q174K, T200A, Q207E, F214L W24V, P25A
>02_RAM705| codons 1-238
PISPIETVPVKLKPGMDGPKVKQVALTEEKIKALTEICTDMEREGKISKIGPENPYNTPI
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPDIVI
YQYVDDLLVGSDLEIGQHRAKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54V, V82T   L10V, I13V, K20I, M36I, N37D, R41K, I66F, H69K, K70R, L89M  
>02_RAM705| codons 1-99
PQITLWQRPVVTVKIGGQLIEALLDTGADDTVLEEIDLPGKWKPKLIVGIGGFVKVRQYD
QILIEFCGKRAIGTVLVGPTPTNIIGRNMLTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004