<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patRAM 01_RAM707 France 2001 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT 47
2 Unknown 165
3 3TC+AZT 73
4 Unknown 92
5 3TC+D4T+RTV 40
6 3TC+D4T 6
7 3TC+D4T+IDV 49
8 3TC+D4T+IDV+RTV 1

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54V, V82T   L10V, I13V, K20I, M36I, R41K, I66F, H69K, K70R, L89M  
>01_RAM707| codons 1-99
PQITLWQRPVVTVKIGGQLIEALLDTGADDTVLEEINLPGKWKPKLIVGIGGFVKVRQYD
QILIEFCGKRAIGTVLVGPTPTNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39I, K49R, V60I, K122E, D177E, Q207E  
>01_RAM707| codons 1-241
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICIEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
V

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004