<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patWIL 01_WIL707 France 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 65
2 3TC+ SQV 34
3 3TC+ RTV+ SQV 99
4 ABC+ RTV+ SQV 21
5 SQV 8
6 None 4
7 3TC+ AZT+ EFV 52
8 Unknown 39

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37T, I62V, L63P, V77I, I93L  
>01_WIL707| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMTLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005