<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patRAI 01_RAI715 France 2001 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ ABC+ 3TC 39
2 NVP+ DDI+ D4T 33

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, G16E, E35D, M36I, R41K, H69K, K70R, L89I  
>01_RAI715| codons 1-99
PQITLWQRPVVTVKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74V, M184V K219E Y181C, G190A   E6D, V8I, K11T, V35T, T39K, E40Q, K43E, R83K, V111I, K122E, D123N, I135T, K173I, Q174K, D177E, V179I, Q207A, R211S, V245E P25A
>01_RAI715| codons 1-250
PISPIDTIPVTLKPGMDGPKVKQWALTEEKIKALTEICKQMEEEGKISKIGPENPYNTPV
FAIKKKNSTRWRKVVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDIGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIII
CQYVDDLYVASDLEIGQHRTKIEELRAHLLSWGFTTPDEKHQKEPPFLWMGYELHPDKWT
VQPIELPEKD

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004