<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patMOU 00_MOUL723 France 2000 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT 87
2 AZT+ DDI 43
3 3TC+ D4T+ SQV 117
4 3TC+ AZT+ SQV 43
5 None 21

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V, T215Y K70S     K11T, V35T, E36A, T39K, K43E, D121H, K122E, D123S, I135T, I142V, S162Y, F171Y, K173S, D177E, V179I, T200A, Q207A  
>00_MOUL723| codons 1-226
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTAICKEMEEEGKISKIGPENPYNTPV
FAIKKKNSTSWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPYRSQNPEIII
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLRWGFYTPDKKHQKEPP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G17E, K20I, M36I, R41K, L63T, I64M, H69K, T74A, L89M  
>00_MOUL723| codons 1-99
PQITLWQRPLVTVRIGEQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QITMEICGKKAIGAVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004