<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patGRA 00_GRA703 France 2000 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 47
2 3TC+ AZT 72
3 D4T+ NFV+ NVP 88
4 ABC+ DDI+ SQV 16
5 D4T+ DDI 10
6 3TC+ D4T+ DDI+ LPV 3

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, L90M   I13V, K14R, K20I, E35D, M36I, R41K, I64M, C67E, H69K, A71V, I72V, T74S, V82I, L89I, I93L  
>00_GRA703| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKLIGGIGGFVKVRQYD
QILMEIEGKKVVGSVLVGPTPINIIGRNIMTQLGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004