Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| MB_patGRA | 00_GRA703 | France | 2000 | HIV1 | G | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+ DDI | 47 |
| 2 | 3TC+ AZT | 72 |
| 3 | D4T+ NFV+ NVP | 88 |
| 4 | ABC+ DDI+ SQV | 16 |
| 5 | D4T+ DDI | 10 |
| 6 | 3TC+ D4T+ DDI+ LPV | 3 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46L, I54V, L90M | I13V, K14R, K20I, E35D, M36I, R41K, I64M, C67E, H69K, A71V, I72V, T74S, V82I, L89I, I93L |
| >00_GRA703| codons 1-99 PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKLIGGIGGFVKVRQYD QILMEIEGKKVVGSVLVGPTPINIIGRNIMTQLGCTLNF |
References
| Author | Title | Citation |
| Montes, B | Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. | JAIDS, 2004 |