<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patMOR 02_MOR735 France 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 256
2 DDI 4
3 DDI+ SQV 17
4 3TC+ D4T+ SQV 13
5 3TC+ D4T+ IDV 21
6 D4T+ SQV 4
7 D4T+ NFV+ SQV 39
8 D4T+ EFV+ NFV+ SQV 52
9 ABC+ RTV+ SQV 21
10 None 13
11 ABC+ D4T+ IDV+ RTV 8
12 ABC+ D4T 12
13 ABC+ NFV 8
14 None 39
15 3TC+ LPV 49
16 3TC 2
17 Unknown 35

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M L10F, G73S K20I, E35G, M36I, I62V, L63P, A71T, I85V I93N
>02_MOR735| codons 1-99
PQITLWQRPFVTIKIGGQLIEALLDTGADDTVLEGINLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKTISTVLVGPTPVNVVGRNLMTQNGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184I, L210W, T215Y   K101P, G190A   V35M, T39K, K43E, E44D, V90I, V118I, D121H, K122E, K166R, F171Y, Q207E, R211K, L228H  
>02_MOR735| codons 1-237
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICKELEEDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLPKKKSVTVLDVGDAYFSIPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPYRKQNPDIVI
YQYIDDLYVASDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFHWMGYELHPD

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005