<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patMOR 99_MOR701 France 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 256
2 DDI 4
3 DDI+ SQV 17
4 3TC+ D4T+ SQV 13
5 3TC+ D4T+ IDV 21
6 D4T+ SQV 4
7 D4T+ NFV+ SQV 39
8 D4T+ EFV+ NFV+ SQV 52
9 ABC+ RTV+ SQV 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y   K101P, G190A   V35M, T39K, K43E, E44D, T69N, V118I, D121H, K122E, K166R, F171Y, Q207E, R211K, L228H  
>99_MOR701| codons 1-240
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICKELEEDGKISKIGPENPYNTPV
FAIKKKNSNKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLPKKKSVTVLDVGDAYFSIPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPYRKQNPDIVI
YQYMDDLYVASDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73S K20I, E35G, M36I, I62V, L63P, A71T  
>99_MOR701| codons 1-99
PQITLWQRPLVTIKIGGQLIEALLDTGADDTVLEGINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTISTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005