<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patGONO 00_GONO705 France 2000 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ AZT 16
2 NFV+ AZT+ 3TC 29
3 NVP+ AZT+ 3TC 3
4 NVP+ NFV+ AZT+ 3TC 18
5 NFV+ AZT+ 3TC 3

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13A, K14R, K20I, M36I, R41K, H69K, L89M  
>00_GONO705| codons 1-99
PQITLWQRPLVTARIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4S, E44D, I135V, Q145V, S162A, K173T, Q174K, D177E, I178M, T200A, Q207E, H235P G45L, P55Q
>00_GONO705| codons 1-239
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKDLKISKIGPENQYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYVYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELPPDKW

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004