<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patSER 00_SER718 France 2000 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT 35
2 AZT+ DDC 73
3 3TC+ D4T 47
4 None 39
5 D4T+ DDI+ SQV 26
6 ABC+ D4T+ NFV 17
7 None 4
8 ABC+ DDC+ EFV 17
9 3TC+ AZT+ DDI+ EFV 13

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Q151M, M184V A62V, V75I, F77L, F116Y K103N P225H K20R, V35T, T39A, E40D, S68G, T69I, R125K, I135L, S162A, T165A, K173T, Q174K, T200A, I202V, Q207D  
>00_SER718| codons 1-236
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICADMEKEGKISKIGPENPYNTPV
FVIKRKDGIKWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYYSVPL
DKDFKKYTAFTIPSLNNETPGIRYQYNVLPMGWKGSPAIFQASMAKILEPFRTKNPDIVI
YQYVDDLYVGSDLEIGQHRAKVEELRDHLLRWGFTTPDKKHQKEHPFLWMGYELHP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, I15V, K20I, M36I, R41K, H69K, L89M  
>00_SER718| codons 1-99
PQITLWQRPLVTVRVGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004