<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patMAN 02_MANG728 France 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ D4T 17
2 None 13
3 NVP 21
4 None 47
5 AZT+ ABC+ 3TC 87
6 None 35
7 LPV 9

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y K219N     T39A, K43E, A98S, I178M, R211K  
>02_MANG728| codons 1-237
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDNKHQKEPPFLWMGYELHPD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L63P  
>02_MANG728| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005