<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patMOL 00_MOLL719 France 1999 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 DDI+ AZT 35
3 AZT+ 3TC 65
4 SQV+ DDC+ AZT 56
5 RTV+ DDI+ D4T 17
6 IDV+ DDI+ D4T 52
7 NVP+ DDI+ D4T 20
8 NVP+ DDI+ D4T+ AZT+ 3TC 1
9 NVP+ DDI+ D4T 3
10 NVP+ NFV+ DDI+ D4T 18
11 NVP+ DDI+ D4T 4

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   Q7E, E35D, M36I, P39Q, R41K, I62V, L63P, I64L, A71V, I72V, V77I, I93L  
>00_MOLL719| codons 1-99
PQITLWERPLVTIKIGGQLKEALLDTGADNTVLEDINLQGKWKPKMIGGIGGFIKVRQYD
QVPLEICGHKVVGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K49R, V60I, K122E, D177E, Q207E  
>00_MOLL719| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQ

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004