<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patMOL 02_MOLI735 France 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 DDI+ AZT 35
3 AZT+ 3TC 65
4 SQV+ DDC+ AZT 56
5 RTV+ DDI+ D4T 17
6 IDV+ DDI+ D4T 52
7 NVP+ DDI+ D4T 20
8 NVP+ DDI+ D4T+ AZT+ 3TC 1
9 NVP+ DDI+ D4T 3
10 NVP+ NFV+ DDI+ D4T 18
11 NVP+ DDI+ D4T 30
12 AZT+ ABC+ 3TC 101

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y     A98G E44D, V118I, K122E, I135T, T165I, G196E, E203K, R211K, K223Q  
>02_MOLI735| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIKELRQHLWKWGFYTPDKKHQQEPPFLWMGYELHPDKWT
VQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I15V, L63P  
>02_MOLI735| codons 1-99
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005