<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patFEU 02_FEU726 France 2002 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI+ IDV 60
2 None 25
3 3TC+ AZT+ IDV 60
4 None 78
5 3TC+ D4T+ RTV+ SQV 70

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K11T, E28A, K32R, V35T, E40D, V60I, V118I, D121H, K122E, D123S, I135T, K173S, Q174R, D177E, I178L, V179I, T200A, Q207A, F214L  
>02_FEU726| codons 1-239
PISPIETVPVTLKPGMDGPKVKQWPLTAEKIRALTEICTDMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
HESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSRNPELII
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V   L10V, I13V, K14R, L19P, K20I, E21D, L33V, M36I, N37D, R41K, F53Y, I64L, H69K, K70R, T74S, L89M  
>02_FEU726| codons 1-99
PQITLWQRPVVTVRIGGQPIDALLDTGADDTVVEEIDLPGKWKPKMIGGIGGYIKVRQYD
QILLEICGKRAIGSVLVGPTPVNVIGRNMLTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004