<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patROU 00_ROUX701 France 2000 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT 126
2 Unknown 182
3 AZT+DDI 15
4 3TC+AZT 14
5 None 172
6 3TC+AZT+NVP 6
7 None 5

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215Y K219E Y181C A98G, V108I V60I, L109I, I135V, S162A, K173T, Q174E, D177E, T200A, I202V, Q207E, V245A, E248K, D250E  
>00_ROUX701| codons 1-250
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTIIDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTENPEIVI
CQYVDDLYVGSDLEIGQHRAKVEELREHLLRWGFYTPDEKHQKEPPFLWMGYELHPDKWT
VQPIALPKKE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, M36I, N37D, L38I, R41K, L63S, I64M, H69K, L89M  
>00_ROUX701| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEEIDIPGKWKPKMIGGIGGFIKVRQYD
QISMEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004