<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patALI 02_ALI705 France 2002 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT|DDI 6
2 DDI 5
3 None 6
4 D4T+DDI 17
5 None 14
6 3TC+AZT+DDI 18
7 None 15
8 3TC+AZT+NFV 14
9 3TC+AZT+EFV 28
10 3TC+AZT+EFV 11
11 None 4
12 3TC+D4T+NVP 6
13 3TC+D4T+NFV 2
14 3TC+D4T 8
15 AZT+DDI 7

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12E, I13V, K14R, G17E, K20I, M36I, L63P, I64L, H69K, L89M  
>02_ALI705| codons 1-99
PQITLWQRPLVEVRIGEQLIEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QIPLEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V K219E K103N, Y181C   K20R, E36D, I135V, S162A, K173A, Q174K, D177E, T200A, Q207E, R211K  
>02_ALI705| codons 1-240
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVDICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAKNPEIVI
CQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDEKHQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004