<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patRON 00_RON713 France 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ D4T 56
2 DDI+ D4T+ ABC 26
3 NFV+ DDI+ 3TC 17
4 NFV+ DDI+ AZT+ 3TC 108

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V   K20T, E35D, M36I, R41K, I62V, I64V, T74A  
>00_RON713| codons 1-99
PQITLWQRPLVTIKIGGQLTEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVRQYD
QVLVEICGHKAIGAVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     D123E, I135T, F214L, D218E  
>00_RON713| codons 1-241
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPEQKHQKEPPFLWMGYELHPDKWT
V

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005