<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patKES 01_KES716 France 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ DDI+ D4T 108
2 NFV+ AZT+ 3TC 28

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215Y       V21I, V35T, V60I, K122P, I135V, S162A, K173T, Q174K, D177E, I178M, Q207E, R211K  
>01_KES716| codons 1-239
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M L89V L10V, I13V, K14R, G16E, K20I, E35D, M36I, R41K, H69K, K70R, T74S, V75I  
>01_KES716| codons 1-99
PQITLWQRPVVTVRIEGQLIEALLDTGADDTVLEDINLPGKWKPKIIGGIGGFIKVRQYD
QILIEICGKRAIGSILVGPTPVNIIGRNVMTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004