<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patROI 00_ROI705 France 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 17
2 SQV+ DDI+ AZT 13
3 SQV+ D4T+ 3TC 21
4 SQV+ RTV+ D4T 13
5 IDV+ DDI+ D4T 146

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, K20R, M36I, R41K, L63N, H69K, K70R, L89I, T91V, I93L  
>00_ROI705| codons 1-99
PQITLWQRPLVTVKIEGQLREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QINIEICGKRAIGTVLVGPTPVNIIGRNILVQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T27P, V35P, D121Y, K122E, D123E, I135T, I142V, K173S, Q174K, D177E, T200A, I202V, Q207A, R211K  
>00_ROI705| codons 1-243
PISPIETVPVKLKPGMDGPKVKQWPLPEEKIKALPEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIVI
YQYMDDLYVGSDLEIGQHRAKVEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQP

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004