<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patALC 02_ALC723 France 2002 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 39
2 NFV+ DDI+ AZT 35
3 SQV+ RTV+ D4T+ 3TC 56
4 NVP+ DDI+ ABC 136

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   K101E, G190A   V35T, E36D, T39K, K43A, E44D, V60I, K104R, D121H, K122E, D123S, I135R, I142V, S162Y, K173L, D177E, I178L, V179I, Q207A  
>02_ALC723| codons 1-241
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICKELEADGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKRSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSRNNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPFRLQNPELII
YQYMDDLYVASDLEIGQHRTKIEELRAHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
V

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M   L10I, I13V, K20I, E35D, M36I, R41K, K43R, L63P, H69K, A71V, L89I  
>02_ALC723| codons 1-99
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVRQYD
QIPIEICGKKVIGTVLVGPTPVNVIGRNIMTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004