<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patSLI 00_SLI725 France 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NVP+ AZT+ 3TC 81

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V D67I G190A   K122E, E138A, E169G, H208P, D237N  
>00_SLI725| codons 38-242
CTEMEKEGKISKIGPENPYNTPVFAIKKKISTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSP
AIFQSSMTKILGPFRKQNPDIVIYQYVDDLYVASDLEIGQHRTKIEELRQPLLRWGFTTP
DKKHQKEPPFLWMGYELHPNKWTVQ

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005