<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patGIR 02_GIR722 France 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 113
2 DDI 43
3 SQV+ D4T 30
4 IDV+ D4T+ 3TC 52
5 SQV+ NFV+ D4T+ 3TC 95
6 SQV+ RTV+ D4T+ 3TC 151

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M L33I, G73S L10I, K20I, E35D, M36I, I62V, L63P, H69N, A71V  
>02_GIR722| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVIEDINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGNKVISTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       R83K, D123E, I135T, T200A, R211K  
>02_GIR722| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQ

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005