<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patBAR 01_BAR714 France 2001 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 DDI+ AZT 261
3 RTV+ DDI+ AZT 104
4 SQV+ RTV+ AZT 17
5 SQV+ AZT 17
6 SQV+ NFV+ AZT+ 3TC 21
7 SQV+ RTV+ AZT+ 3TC 17
8 SQV+ RTV+ NVP+ AZT+ 3TC 8
9 NFV+ EFV+ DDI+ D4T 8
10 RTV+ D4T+ APV+ ABC 26
11 LPV+ D4T+ ABC 55

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215F   K103N, Y181C, G190A   V35T, K49R, I135L, S162C, E169D, K173A, Q174K, Q207E, R211K, L228R  
>01_BAR714| codons 1-237
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPDIVI
CQYMDDLYVASDLEIGQHRTKIEELREHLLKWGFFTPDKKHQKEPPFRWMGYELHPD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A   L10I, K14Q, I15V, K20R, E35D, M36I, P39Q, R41K, R57K, Q61N, L63C, E65D, T74S, L89M  
>01_BAR714| codons 1-99
PQITLWQRPIVTIQVGGQLREALLDTGADDTVLEDINLQGKWKPKMIGGIGGFIKVKQYD
NICIDICGHKAIGSVLVGPTPANIIGRNMLTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004