<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patBAR 99_BAR710 France 1999 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 DDI+ AZT 261
3 RTV+ DDI+ AZT 104
4 SQV+ RTV+ AZT 17
5 SQV+ AZT 17
6 SQV+ NFV+ AZT+ 3TC 21
7 SQV+ RTV+ AZT+ 3TC 17

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A   K14Q, I15V, K20R, E35D, M36I, R41K, R57K, Q61N, L63C, E65D, L89M  
>99_BAR710| codons 1-99
PQITLWQRPLVTIQVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NICIDICGHKAIGTVLVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215F       V35T, K49R, I135L, S162C, E169D, K173A, Q174K, Q207E, R211K, T240A  
>99_BAR710| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFFTPDKKHQKEPPFLWMGYELHPDKWA
VQ

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004