<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patMASS 00_MASS701 France 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 52
2 SQV+ AZT+ 3TC 21
3 SQV+ RTV+ D4T+ 3TC 47
4 SQV+ NFV+ AZT+ 3TC 21
5 SQV+ NFV+ DDI+ D4T 43
6 SQV+ NVP+ NFV+ D4T 8
7 SQV+ NFV+ D4T+ 3TC 73

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54L, I84V, L90M   L10I, K20R, E35D, M36I, N37S, R41K, I62V, L63P, A71V, Q92K  
>00_MASS701| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDISLPGKWKPKLIGGIGGFLKVRQYD
QVPIEICGHKVIGTVLVGPTPVNVIGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y       K20R, K43E, V118I, D123E, S162Y, T200A, E203D, H208Y, R211K  
>00_MASS701| codons 1-242
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIDELRQYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQ

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005