<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patESTU 01_ESTU702 France 2001 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 DDC 21
2 None 13
3 AZT+ 3TC 17
4 SQV+ DDC+ D4T+ AZT+ 3TC 39
5 RTV+ D4T+ AZT+ 3TC 52
6 NFV+ DDI+ AZT+ 3TC 13
7 NFV+ DDI+ AZT 4
8 NFV+ IDV+ AZT+ 3TC 25
9 NFV+ IDV+ DDI+ AZT 21
10 SQV+ RTV+ DDI+ D4T 155

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219Q     V35T, T39A, K49R, V60I, V118I, K122E, S134N, I135T, T139I, I142T, D177E, I178M, Q207E  
>01_ESTU702| codons 1-240
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELEKEGKISRIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPNTNNEIPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLWRWGFYTPDQKHQKEPPFLWMGYELHPDKWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M V11I, G73S L10V, I13V, K20I, L33V, I62V, L63P  
>01_ESTU702| codons 1-99
PQITLWQRPVITVKIGGQLIEALLDTGADDTVVEEMNLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGHKAISTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004