<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patMUZ 00_MUZ714 France 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ NFV 2
2 ABC+ DDI+ NFV 16

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L10F I13V, E35D, M36I, R41K, R57K, H69K, L89I  
>00_MUZ714| codons 1-99
PQITLWQRPFVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R       V35T, V60I, K122E, D123S, S162A, K173S, Q174K, D177E, I178M, T200A, E203K, Q207A, R211S  
>00_MUZ714| codons 1-237
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRSKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIKELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPD

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004