<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patGAR 01_GAR706 France 2001 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ NNRTI 41
2 None 5

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N, G190A   V21I, V35T, T39K, K43E, V106I, D121H, K122E, D123S, S162C, K173I, Q174K, D177E, Q207A, R211S, K238R  
>01_GAR706| codons 19-242
PKIKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFR
ELNKRTQDFWEVQLGIPHPAGLKKNKSITVLDVGDAYFSVPLHESFRKYTAFTIPSINNE
TPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRIKNPEIVIYQYVDDLYVASDLEIGQH
RTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWTVQ

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004