<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patTAF 02_TAF703 France 2002 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT 53
2 Unknown 454
3 3TC+AZT+NFV 36

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I   I13V, G16E, K20I, E35D, M36I, R41K, I64M, H69K, I72V, L89T  
>02_TAF703| codons 1-99
PQITLWQRPLVTVKIEGQLIEALLDTGADDTVLEDINLPGKWKPKIIGGIGGFIKVRQYD
QILMEICGKKAVGTVLVGPTPVNIIGRNTLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62V     V35T, V60I, V90I, K122E, I135V, S162A, K173T, Q174K, D177E, T200A, Q207E  
>02_TAF703| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FVIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQ

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004