<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patBELLE 01_BELA701 France 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC+ AZT 73
2 SQV+ D4T+ 3TC 82
3 SQV+ RTV 39
4 SQV+ NFV+ 3TC 39
5 SQV+ NVP+ NFV+ ABC+ 3TC 30
6 AZT+ ABC+ 3TC 21
7 NFV+ AZT+ ABC+ 3TC 13
8 EFV+ APV+ ABC+ 3TC 8
9 ABC+ 3TC 39
10 DDI+ ABC+ 3TC 20

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, T215F K219Q K101E, Y181C, G190A A98G I178M, H208Y, R211K, D218E, L228H  
>01_BELA701| codons 1-238
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
CQYVDDLYVASDLEIGQHRTKIEELRQYLLKWGFFTPEQKHQKEPPFHWMGYELHPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, E35D, N37D, L63P, I93L  
>01_BELA701| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005