<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patSANS 02_SANS728 France 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 RTV| IDV| EFV| D4T| AZT| APV| ABC| 3TC 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q K103N, G190S   V35M, T39A, K49R, E79Q, R83K, V118I, S162D, Q174H, I202V, E203A, Q207E, R211K, F214L, L228H  
>02_SANS728| codons 1-245
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAEMEKEGKISRIGPENPYNTPV
FAIKKKNSTRWRKLVDFRQLNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKHNPDIVI
YQYVDDLYVSSDLEIGQHRTKVAELREHLLKWGLFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54L, I84C   L10I, I15V, E35D, N37D, L63P  
>02_SANS728| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDMDLPGRWKPKLIGGIGGFLKVRQYD
QIPIEICGHKAIGTVLVGPTPVNCIGRNLLTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005