<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patMICH 01_MICL706 France 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 LPV| IDV| EFV| DDI| DDC| D4T| AZT| 3TC 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M Q58E, G73C I15V, Q18E, L19I, M36L, L38W, I62V, L63P, A71T, I72T, I85V, Q92K  
>01_MICL706| codons 1-99
PQITLWQRPLVTIKVGGEIKEALLDTGADDTVLEELNWPGRWKPKLIGGIGGFVKVREYD
QVPIEICGHKTTCTVLVGPTPANIVGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, V75M, M184V, T215F K219Q Y188L V179D E6K, K20R, V35M, T39A, V60I, K102E, K103R, V118I, K122E, I135T, S162Y, Q207E, R211K, F214L, D218E, K238R  
>01_MICL706| codons 1-239
PISPIKTVPVKLKPGMDGPRVKQWPLTEEKIKALMEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKERKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIDI
YQYVDDLLVGSDLEIGQHRTKIEELREHLLKWGLFTPEQKHQKEPPFLWMGYELHPDRW

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005