<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patMUK 03_MUK733 France 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 DDI 21
2 None 13
3 AZT 8
4 None 4
5 AZT 12
6 3TC+ D4T+ DDI 8
7 D4T+ DDI 113
8 None 26
9 AZT 4
10 None 4
11 D4T+ DDI 8
12 None 30
13 AZT 8
14 None 102

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N K219Q     V35T, E36A, T39E, K103R, K122E, D123S, I135T, K173A, D177E, I178V, T200V, E203K, Q207E, R211K, F214L K20G
>03_MUK733| codons 17-241
DGPGVKQWPLTEEKIKALTAICEEMEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVD
FRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTN
NETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEVVIYQYMDDLYVGSDLEIG
QHRVKIKELREHLLKWGLTTPDQKHQKEPPFLWMGYELHPDKWTV

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004