<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patBOU 01_BOUF707 France 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NVP| DDI| AZT| 3TC 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N, Y181C V108I V35I, V60I, R83K, K122E, D123E, I135T, T200A  
>01_BOUF707| codons 32-236
KALIEICTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKKTQDFWEVQ
LGIPHPAGLKKNKSVTILDVGDAYFSVPLDEEFRKYTAFTIPSTNNETPGIRYQYNVLPQ
GWKGSPAIFQSSMTKILEPFRKQNPDIVICQYVDDLYVGSDLEIGQHRAKIEELRQHLLR
WGFTTPDKKHQKEPPFLWMGYELHP

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005