<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patHEN 02_HEN716 France 2002 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ AZT+ ABC+ 3TC 4
2 NFV+ AZT+ ABC+ 3TC 56
3 LPV+ DDI+ ABC 25
4 DDI+ D4T+ ABC 6

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L90M Q58E I13V, K20I, E35G, M36I, R41K, H69K, K70R, V82I, L89I  
>02_HEN716| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEGINLPGKWKPKMIGGIGGFVKVREYD
QILIEICGKRAIGTVLVGPTPINIIGRNIMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V   V106A, G190A   K22N, V35P, T39A, E40D, K43R, V60I, A98S, K122E, D123S, I135T, E138A, I142V, S162A, K173T, Q174K, D177E, I178V, T200A, Q207E, R211S, F214L L26F, N81T
>02_HEN716| codons 1-243
PISPIETVPVKLKPGMDGPKVNQWPFTEEKIKALPEICADMEREGKISKIGPENPYNTPI
FAIKKKDSTKWRKVVDFRELTKRTQDFWEVQLGIPHPSGLKKKKSATVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNATPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEVVI
YQYVDDLYVASDLEIGQHRAKIEELREHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQP

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004