<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patHEN 01_HEN734 France 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ AZT+ ABC+ 3TC 4
2 NFV+ AZT+ ABC+ 3TC 56
3 LPV+ DDI+ ABC 2

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184I       V35T, T39A, E40D, K43R, V60I, A98S, K122E, D123S, I135T, E138A, I142V, S162A, K173T, Q174K, D177E, I178V, T200A, Q207E, R211S, F214L  
>01_HEN734| codons 1-241
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICADMEREGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNATPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEVVI
YQYIDDLYVGSDLEIGQHRAKIEELREHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
V

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L90M   I13V, K20I, E35G, M36I, R41K, H69K, K70R, V82I, L89M  
>01_HEN734| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEGINLPGKWKPKMIGGIGGFVKVRQYD
QILIEICGKRAIGTVLVGPTPINIIGRNMMTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004