<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patSCHE 02_SCHE715 France 2002 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI+ IDV 60
2 D4T+ DDI+ NVP 132

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   Y181C V108I P4S, V35T, E36D, V90I, K104R, K122E, I135V, S162A, E169G, K173A, Q174K, D177E, I178M, V189I, T200A, Q207E, R211K, H221Y, F227I  
>02_SCHE715| codons 1-241
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKRSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILGPFRAKNPEMVI
CQYMDDLYIGSDLEIGQHRAKIEELREHLLKWGFYTPDKKYQKEPPILWMGYELHPDKWT
V

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, G16E, K20I, M36I, R41K, L63H, H69K, K70R, I72V, L89M, I93L  
>02_SCHE715| codons 1-99
PQITLWQRPVVTVKIEGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIHIEICGKRAVGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004