<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patTOM 01_TOM706 France 2001 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI 120
2 D4T 27
3 None 13

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y       V35T, T39A, K64H, V118I, D123E, I135L, S162H, K173T, Q174K, I195L, T200A, Q207A, R211K, L228R  
>01_TOM706| codons 18-241
GPKVKQWPLTEEKIKALTEICAELEKEGKISKIGPENPYNTPVFAIHKKDSTKWRKLVDF
RELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSLNN
ETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRTKNPDIVIYQYMDDLYVGSDLELGQ
HRAKIEELRAHLLKWGFYTPDKKHQKEPPFRWMGYELHPDKWTV

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004