<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patLECO G 02_LECG719 France 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ D4T 74
2 DDI+ D4T+ ABC 82
3 NVP+ AZT+ 3TC 156

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   G190A A98G V60I, R83K, K122E, D123E, I135T, V245E  
>02_LECG719| codons 28-249
EEKIKALVEICTELEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKKTQDF
WEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPLDEEFRKYTAFTIPSTNNETPGIRYQYN
VLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVASDLEIGQHRTKIEELRQ
HLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPEK

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005