<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patDAR 01_DAR706 France 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 SQV| RTV| EFV| DDI| AZT| ABC| 3TC 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73T K20R, M36I, N37D, I62V, L63P, A71I, I93L  
>01_DAR706| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKIITTVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V       E36G, K46Q, K49R, A158S, Q174H, I178M, G196E, Q207E, R211K  
>01_DAR706| codons 1-244
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVGICTEMEKEGQISRIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKHNPDMVI
YQYVDDLYVGSDLEIEQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPI

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005