<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patVIG 02_VIG701 France 2002 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ SQV 245
2 3TC+ D4T+ IDV+ RTV+ SQV 1
3 3TC+ D4T+ IDV+ RTV 6

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54A, V82T   L10I, I13V, K14R, K20I, E35N, M36I, N37D, R41K, Q61H, L63P, C67E, H69K, I72V, T74S, L89M  
>02_VIG701| codons 1-99
PQITLWQRPIVTVRIGGQLIEALLDTGADDTVLENIDLPGKWKPKIIGGIGGFAKVRQYD
HIPIEIEGKKAVGSVLVGPTPTNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       V35T, V60I, I135V, K173T, D177E, I178M, T200A, E203K, Q207D, R211K  
>02_VIG701| codons 1-243
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEMVI
YQYVDDLYVGSDLEIGQHRAKIKELRDHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQP

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004