<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patFRAI 02_FRA716 France 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ DDI 17
2 3TC 4
3 3TC+ D4T+ SQV 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W T215D     K43R, R83K, V90I, V118I, I135V, K166R, I202V  
>02_FRA716| codons 1-238
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEREGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLWRWGFDTPDKKHQKEPPFLWMGYELHPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    P39T, L63P  
>02_FRA716| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLTGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005