<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patFRE 00_FRE705 France 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 87
2 DDI+ AZT 60
3 DDC+ AZT 17
4 None 26
5 SQV+ DDI+ D4T 21
6 None 30
7 NFV+ D4T+ 3TC 73
8 NFV+ D4T+ ABC 34
9 NFV+ DDI+ D4T 34

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
V75T, Y115F, M184V       K11R, E53D, V118I, D123E, I135T, S162Y, T200I, R211G, F214L  
>00_FRE705| codons 1-242
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPDNPYNTPV
FAIKKKDSTKWRKLTDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAFFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRIKIEELRQHLLGWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D I15V, E35G, M36I, N37D, L63P, V75I, I93L  
>00_FRE705| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADNTVLEGIDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTILVGPTPVNIIGRDLLTQLGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005