<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patTERR 02_TERR707 France 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 34
2 RTV+ DDI+ AZT 21
3 IDV+ AZT+ 3TC 17
4 SQV+ RTV+ AZT+ 3TC 21
5 SQV+ RTV+ DDI+ D4T 4
6 SQV+ RTV+ D4T+ 3TC 17
7 SQV+ D4T+ 3TC 17
8 SQV+ NFV+ D4T+ 3TC 8
9 SQV+ NVP+ NFV+ D4T 17
10 SQV+ NFV+ D4T 8
11 D4T 21
12 None 69
13 EFV 43
14 NVP 7
15 NVP+ LPV 5
16 LPV+ 3TC 58

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219R Y188L, G190A   V35I, T39A, E44D, G45E, K101Q, V118I, D123E, V179I, I202V, E203D, H208Y, R211K L12G
>02_TERR707| codons 1-239
PISPIETVPVKGKPGMDGPKVKQWPLTEEKIKALIEICAELEKDEKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLLVASDLEIGQHRTKVDELRQYLWKWGFYTPDRKHQKEPPFLWMGYELHPDKW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48A, I54V, V82A, L90M   L10I, K20R, E35D, M36I, N37E, I62V, L63S, I64M, A71V, I93L  
>02_TERR707| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIELPGRWKPKLIAGIGGFVKVRQYD
QVSMEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005